SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB11G14640.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB11G14640.1
Domain Number 1 Region: 320-420
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.02e-24
Family B3 DNA binding domain 0.0053
Further Details:      
 
Domain Number 2 Region: 60-157
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.67e-21
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB11G14640.1
Sequence length 435
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:11:3061778:3067276:-1 gene:OB11G14640 transcript:OB11G14640.1 description:"Uncharacterized protein "
Sequence
MRDMGRRSREGEGEEEERAVAASRVVREEQGGRMEKEKRKEKGKGKEKERREEDKHFGRS
FFRVLLTPQSLERMKIPSSFNQCLQNQPTGMVSLADRSGNTWSAELTSDSEGFCFVHGWK
QFVRDNFIQCGQFVVFTYDKRSHFSVVVFDPSGIDKMPSHFTHLSKKLIIKTESDEMGID
NAAITSEKMAPLPKDNNRTAGKIAIDVDCHMEDRVLLKKSNEANVSGSAKRKRSRASLGK
SKATSISHNSTKDSSNNMSDEDMSCSKSPKAPFLMRFMSGEVARRGKCMSRGQRQLRVIS
QRRPVTEAEKDHALQRAKEFKSKNPFVLQIMMESYVYVGFFMNIPCEFVRECLPRTSKRI
TLWDPQGKAWAVNYVYYSDRSVGSFSGGWGKFAVGNNLEKFDVCVFELVQKDNIKVHIYR
VVPEITPPKLQADKR
Download sequence
Identical sequences J3N6M8
OB11G14640.1 XP_006663274.2.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]