SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB11G22640.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB11G22640.1
Domain Number 1 Region: 10-61
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000265
Family FemXAB nonribosomal peptidyltransferases 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OB11G22640.1
Sequence length 126
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:11:11983221:11984822:1 gene:OB11G22640 transcript:OB11G22640.1 description:"Uncharacterized protein "
Sequence
MGLPFVCAFSWGRPYLTREFFHRLGEKMGDKVMLIVAEHDDKLVAGALNRIGGDTLFVAY
GDVCQMLISPTCILKLAIISCRYFLNPGFGIAIGHYLAHETAQVRISWQHNIIIKQTKLL
PAQLRG
Download sequence
Identical sequences J3N8X8
OB11G22640.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]