SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB12G22670.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB12G22670.1
Domain Number 1 Region: 33-161
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000451
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OB12G22670.1
Sequence length 161
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:12:12051318:12052572:-1 gene:OB12G22670 transcript:OB12G22670.1 description:"Uncharacterized protein "
Sequence
MTSHPCAARPSKGSSKNSKNMALNDGATAIAMAKSEVLVREYDRERDMEAIEKLERSCEI
GTGKGFSIVTNMMGDPLCRIRLFPLHVMMVAEVAGGEGKELVGVARGCVKRVATGLGGDD
GGTVAAGYILGLRVSPLHRRKGIGSKLVKSVEAWAALHGAR
Download sequence
Identical sequences J3NE59
OB12G22670.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]