SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OB12G25550.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB12G25550.1
Domain Number 1 Region: 117-261
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-47
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 760-838
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000301
Family PB1 domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB12G25550.1
Sequence length 897
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:12:14217157:14223300:-1 gene:OB12G25550 transcript:OB12G25550.1 description:"Uncharacterized protein "
Sequence
MKLSPSAAPDTLQALPENDGEQRCLNSELWHACAGPLVSLPMVRSRVVYFPQGHSEQVAA
STNKEVDAQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKEPFLPME
LGAASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIARDLHEN
EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNDNNQLLLGIRRANRPQTVM
PSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVG
MRFRMLFETEESSVRRYMGTITSISDLDSVRWPNSHWRSVKVGWDESTTGDKQPRVSLWE
IEPLTTFPMYPSAFPLRLKRPWASGLPMHGMFNGGGNDDFARYPSLMWLRDGNRGAQTLN
FQGHGISPWLQPRIDSPLLGVKTDTYQQMAAAALEEIRSGDNLKQPSATLQYQQTQNLNG
GLNSLFASHVLQQMHYQTPQSPLQAVQQGHCQNTGDSGFVQGQLTQLQLLKEQEFQQQQQ
QQRQQILQEQSHHEMPQQLPSSDPRIADVASESGSATQAPSSLLNGSSFYHQNLLEGNRN
PSLQLHNNFHNFSSQEASDILSLPPSSQLMASNGWPSKQLAVESIVHPEAQPMLPKIEKV
NHHTSISHFPGTFPSQSARGCSVVQDCGADADNRLLSSSFELQDGMTSIISDASRETDTM
AIPLLRYNGADLTTENTLATSNCLGESGTFNHLNNVCVNPSQGATFVKVYKSGSLGRSLD
ISRFSSYCELRSELEHLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFANSVWC
IKILSPQEVQKLVRGGDGLLSSPGARIQQSNACDDYSASHNMQNIPGNIASVAPLDY
Download sequence
Identical sequences J3NEZ7
XP_015698719.1.55871 OB12G25550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]