SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|408402656|ref|YP_006860639.1| from Candidatus Nitrososphaera gargensis Ga9.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|408402656|ref|YP_006860639.1|
Domain Number 1 Region: 51-324
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 3.14e-59
Family Galactose oxidase, central domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|408402656|ref|YP_006860639.1|
Sequence length 340
Comment Kelch repeat-containing protein [Candidatus Nitrososphaera gargensis Ga9.2]
Sequence
MAARTYAIIIGAGIATAAAAIAIAFAIFISPALTVSPTPAAPSPAWSEGEPMPTPRTEIA
GAAVDGKIYIIGGFDRFGRAVSTVEVYDPENDQWNTSAPLPQPLHHAAAASYNGTLYVVG
GYLEDNTPSNKLLAYDPETNEWQELAPMPTARGALTANFVNGILYALGGVNSSFGSPAAP
LATNEAYDPETDSWTQKAPMPTPRQHLASVVLDRLYVIGGRIDSLSSNLDAHEAYDDQND
NWIKLSPMPSKRGGLAAAPSYADDHIYVFGGESPTGTFNNNERYNPLNDSWSSATPMPDP
RHGLAAVTVDNKIYVIGGGPQPGLTVSGTNQIYPTYYPMM
Download sequence
Identical sequences K0IGP3
gi|408402656|ref|YP_006860639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]