SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|408403861|ref|YP_006861844.1| from Candidatus Nitrososphaera gargensis Ga9.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|408403861|ref|YP_006861844.1|
Domain Number 1 Region: 10-120
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.53e-22
Family Toll/Interleukin receptor TIR domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|408403861|ref|YP_006861844.1|
Sequence length 203
Comment hypothetical protein Ngar_c12470 [Candidatus Nitrososphaera gargensis Ga9.2]
Sequence
MSDTENPVAIFISYNSADKQIASNIAIFLAAENIPTWFDEWKVSAGDSIVGEVQEGLKGC
THFLILWSKNSNKSNWVRKELESTIARAIQTKVPRIIPIRLDDTPLPALLADIKYLRYRG
GTERDRYDLVESISGKKPSADFIRAIVKKYKEVVRDPDAEGPFEYKVCPECGSDNLEGSS
FVSSDEEFYVLGCKECGWSTVSQ
Download sequence
Identical sequences K0IJ46
gi|408403861|ref|YP_006861844.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]