SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|408406006|ref|YP_006863990.1| from Candidatus Nitrososphaera gargensis Ga9.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|408406006|ref|YP_006863990.1|
Domain Number 1 Region: 815-999,1336-1563
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-81
Family DNA polymerase I 0.000000691
Further Details:      
 
Domain Number 2 Region: 477-794
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.32e-49
Family DnaQ-like 3'-5' exonuclease 0.00000192
Further Details:      
 
Domain Number 3 Region: 1001-1104,1298-1336
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 7.59e-20
Family Intein (protein splicing domain) 0.016
Further Details:      
 
Domain Number 4 Region: 354-440
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000000204
Family Intein endonuclease 0.011
Further Details:      
 
Domain Number 5 Region: 1212-1285
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000000234
Family Intein endonuclease 0.017
Further Details:      
 
Domain Number 6 Region: 124-223,442-482
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.0000000994
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.03
Further Details:      
 
Weak hits

Sequence:  gi|408406006|ref|YP_006863990.1|
Domain Number - Region: 265-338
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0193
Family Group I mobile intron endonuclease 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|408406006|ref|YP_006863990.1|
Sequence length 1578
Comment DNA polymerase [Candidatus Nitrososphaera gargensis Ga9.2]
Sequence
MPDRRKRLDDLPELPEGRPALLLSAVYSGEEKKVYLKFYDPKDNVIYHWRDRTDHKPYCY
TKMQFAEQAELVAQKETKYTLEQVKKRDIIIDKEIDVLKVLAPDPLSIGGTDNSFREKVT
SWECYDIATEILTKEGGWKSYYQLQDDEVVATYNATTRKFEWQQIETKVDYDYSGDMYGL
HAKTIDFLVTPNHRIFLWNERGDVKCMLAKELYEQQEQLRPNYRPFPFGWSIHKSAESGF
DGDADIDRFTLPQSSWRCSEVDIPLEEFVEFLGWFIAEGGVGGLGNETYINLILSTDKDP
WQRLKHMIESWGMKVWTKNNNDTHSTMIIFSSKDLADWIRANCYTCSIHRSHYKRVPAAI
KNLPTRYLKIFLKNLFLGDGFLRDGDSGQLRTTSEALADDIQEIACKCGYSATIKQKPAI
VDNRGWQFAESYVVTLSTHRTVTSPNQRITKQQYVGKVWCVKVPNGIVYVRRNKKPYWCG
NSDIKYHENYLYDRSLIPGLYYMRKGEQITPFEYPISEKVQFALKSLLWDKIKEAGESGK
EYRQYITNWANLLNQPIPELKRVAVDIEVETEEGRMPNPRDHDKRVTAVGFVASDGFRKV
LVLANNTPNNGEPLIPEAEPCSTEKELLEKAFRIINKYPIVITFNGDDFDLPYLYARSQD
SRIDPNGVAIPKDKVPIMVKKESFIKHGMQAEPVGIRHGIHIDLYRTFDNRSIQIYAFSR
AYTEHTLNAICEALLNDSKIEFEGDIADLPIQKLAEYCLKDADLTYRLTSFNDNLLMRLL
VVISRIGRLSVDDIARFGVNQWIRGILYYEHRQRNELIPSRSELEAKGSASTTAVIKEKK
YRGGEVVEPTAGIHFNVVVLDFASLYPSIIKVHNLSYETINCPHEDCRENKVEGTTHWVC
KRKKGLTSLLIGSLRDLRVNYYKYLAKDKTLPPQERQLYNVVSQAIKVILNASYGVMGAE
IFPLYCLPVADATAALGRSTINRTINRCKEIGIEVVYGDSVLPDTPIVIRRKDKSIDIVP
IESLMPKTVTASRYVGFGNIEVLTESGFSGIKYVYRHKVKKKGYRILTRKGFVECTEDHS
LVVNNKEIKPSELRIGDRIELVPFKTQSLFGIDPDLAWLFGFFIAGGTCGTYYYSPASET
ASKTLQIKYSWKIANQNEAALMKAQRIMQQHLGLETNVIDTRKSSATYALVPRKEIKMLV
DYFRLLCYRGSNKAIPQCILNANIEAKKAFIEGLMVGDGNMDENGLVTLDQIHKTVSAGV
VAILEELGMEYSLQIRDDKTNVCRIRIIKDASDKRIKQADIIKKIEVFEIDDYVYDLETE
NHHFCGGIGNVLLHNTDSLFLKNPSPTAIDEVAAWARNTLGVDLEIDKQYRYVVFSDLKK
NYLGVLSDGTVDVKGLTGKKSHTPPFIRKAFYDILAILGRVNSEKDFESAKESIKNVILQ
NAKNLEARKIPLEDLSFNVTINKSLSTYGKKTGAKTVDGRSTDTYKGLPQHIKAAKMLVD
ANKREIRAGDVISYVKIKNGEGVKPVELAKPEEIDTEKYLETMESTFEQVLSALNFDFKS
VLGKPRQQSLDELFWSRS
Download sequence
Identical sequences K0IMJ1
gi|408406006|ref|YP_006863990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]