SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407714541|ref|YP_006835106.1| from Burkholderia phenoliruptrix BR3459a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407714541|ref|YP_006835106.1|
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.64e-107
Family G proteins 0.0000000257
Further Details:      
 
Domain Number 2 Region: 484-605
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-44
Family Translational machinery components 0.00000773
Further Details:      
 
Domain Number 3 Region: 255-281,310-407
Classification Level Classification E-value
Superfamily Translation proteins 3.53e-36
Family Elongation factors 0.0001
Further Details:      
 
Domain Number 4 Region: 609-698
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.45e-31
Family EF-G/eEF-2 domains III and V 0.00015
Further Details:      
 
Domain Number 5 Region: 409-486
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.01e-25
Family EF-G/eEF-2 domains III and V 0.0000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407714541|ref|YP_006835106.1|
Sequence length 701
Comment elongation factor G [Burkholderia phenoliruptrix BR3459a]
Sequence
MPRKTPIERYRNIGISAHIDAGKTTTTERILFYTGVTHKIGEVHDGAATMDWMEQEQERG
ITITSAATTAFWKGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQ
PQSETVWRQANKYKVPRIAFVNKMDRVGADFFRVQRQIGDRLKGVAVPIQIPVGAEEHFQ
GVVDLVKMKAIVWDDDSQGIKFEYQDIPAELAATAKEWHDKMVEAAAEASEELLDKYLGG
ETLTEEEIKQGLRQRTIANEIVPMLCGSAFKNKGVQAMLDAVIDYLPSPVDVPAILGHDE
HDNEAERHPNDDEPFSALAFKIMTDPFVGQLIFFRVYSGVVNSGDTVYNPVKEKKERLGR
ILQMHANERKEIKEVRAGDIAAAVGLKEATTGDTLCDPNKVIILEKMIFPEPVISQAVEP
KTKADQEKMGIALNRLAQEDPSFRVQTDEESGQTIISGMGELHLEILVDRMKREFGVEAT
VGKPQVAYRETVRNKVEDVEGKFVKQSGGRGQYGHAVITLEPAQQGKGYEFVDAIKGGVI
PREFIPAVDKGIQETLKAGVLAGYPVVDVKVTLTFGSYHDVDSNENAFRMAGSMAFKEAM
RKAKPVLLEPMMAVEVETPEDFMGNVMGDLSSRRGLVQGMEDIAGGGGKLVRAEVPLAEM
FGYSTSLRSATQGRATYTMEFKHYAETPNNVAEAVINAKQK
Download sequence
Identical sequences K0DUI3
WP_015003588.1.42974 gi|407714541|ref|YP_006835106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]