SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003523 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003523
Domain Number 1 Region: 256-338
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 1.7e-16
Family PA3566-like 0.019
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily EF-hand 0.0000000644
Family Polcalcin 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003523   Gene: ENSGGOG00000003584   Transcript: ENSGGOT00000003603
Sequence length 353
Comment pep:novel chromosome:gorGor3.1:20:31005282:31020657:-1 gene:ENSGGOG00000003584 transcript:ENSGGOT00000003603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFRRADKNDDGKLSFEEFQNYFADGVLSPGELQELFSGIDGHLTDNLETEKLCDYFSEHL
GVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGA
SDTLEAQARGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGHSSEAEMQ
WRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLR
EEDLAKGPDLHILVAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMPDGASF
TLYEFWQDEASWRRHQQSPGSKAFQRVLIDHLRAPDTLTTVFFPASWWITNNN
Download sequence
Identical sequences G3QLZ9
ENSGGOP00000003523 ENSGGOP00000003523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]