SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005624 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005624
Domain Number 1 Region: 27-168
Classification Level Classification E-value
Superfamily EF-hand 3.66e-36
Family Calmodulin-like 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005624   Gene: ENSGGOG00000005743   Transcript: ENSGGOT00000005770
Sequence length 173
Comment pep:novel chromosome:gorGor3.1:4:665934:673217:1 gene:ENSGGOG00000005743 transcript:ENSGGOT00000005770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDSDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDAAGNLDYKALSYVITHGEEKEE
Download sequence
Identical sequences G3QSI5
XP_004038348.1.27298 ENSGGOP00000005624 ENSGGOP00000005624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]