SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008965 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008965
Domain Number 1 Region: 198-292
Classification Level Classification E-value
Superfamily Immunoglobulin 1.47e-19
Family I set domains 0.0096
Further Details:      
 
Domain Number 2 Region: 105-205
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-17
Family I set domains 0.071
Further Details:      
 
Domain Number 3 Region: 7-102
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000359
Family V set domains (antibody variable domain-like) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008965   Gene: ENSGGOG00000009172   Transcript: ENSGGOT00000009213
Sequence length 369
Comment pep:novel chromosome:gorGor3.1:19:40827605:40833092:-1 gene:ENSGGOG00000009172 transcript:ENSGGOT00000009213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTRALKDERFQLE
EFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLAVAPENPVVEVREQAVEGG
EVELSCLVPRSRPAATLRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIIC
EAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWN
RGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQT
SVPYAIVGGILALLVFLIICVLVGMVWCSVRQKGSYLTHEASGLDEQGEAREAFLNGSDG
HKRKEEFFI
Download sequence
Identical sequences ENSGGOP00000008965 ENSGGOP00000008965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]