SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022932 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022932
Domain Number 1 Region: 233-325
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000722
Family I set domains 0.006
Further Details:      
 
Domain Number 2 Region: 36-124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000984
Family V set domains (antibody variable domain-like) 0.0018
Further Details:      
 
Domain Number 3 Region: 346-395
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000041
Family I set domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022932   Gene: ENSGGOG00000026338   Transcript: ENSGGOT00000027106
Sequence length 407
Comment pep:novel chromosome:gorGor3.1:19:39985034:39993209:1 gene:ENSGGOG00000026338 transcript:ENSGGOT00000027106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSSAPSCRWHVPWQRLLLTATNPRNWNLPTTAHVTVEALLSDAAEGQEVVLLVYHLPQ
DCLGYKWYKGDRVAANHQIIGYVIDTPGPAYSDQEMINSYACLLIHNVTQNDTGFYTLQV
IKKGQSDVGTQPEISLSQAPHASPMDLTLRKTLEQIFTSCPQAVAPRAAYQLWFSSQSLK
LNHLLQLSESVRALYIDSAGGSEAGVQVCSPQSPRAPFIHFTYDSILILLAELPKPSVTS
NNSNPMEDKDAVALTCKPETQGTTYLWWVNGQSLPASSRLQLSNNNRTLTVLNVTRNYTG
PYECEIRNRVSASHSYPVTLDVLCSPGCQPKLSPALTKNKRGMGCSCHRRLEVPNQEYSW
LINEKLQQYTQELFIPKITAKNSGVYACFVRNSATDLSKFTVKRITV
Download sequence
Identical sequences ENSGGOP00000022932 ENSGGOP00000022932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]