SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026156 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026156
Domain Number 1 Region: 62-155
Classification Level Classification E-value
Superfamily FKBP-like 9.81e-29
Family FKBP immunophilin/proline isomerase 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026156   Gene: ENSGGOG00000016008   Transcript: ENSGGOT00000034217
Sequence length 156
Comment pep:known chromosome:gorGor3.1:X:69371885:69387415:1 gene:ENSGGOG00000016008 transcript:ENSGGOT00000034217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMAGLLKGLVRQLEQFRVEQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGG
NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVATQYSEDKARQGGDLGWMTRGSMVGPFQ
EAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Download sequence
Identical sequences G3RIU6
ENSGGOP00000026156 ENSGGOP00000026156 XP_004064434.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]