SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003220 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003220
Domain Number 1 Region: 112-208
Classification Level Classification E-value
Superfamily Immunoglobulin 3.68e-22
Family C2 set domains 0.00000309
Further Details:      
 
Domain Number 2 Region: 400-500
Classification Level Classification E-value
Superfamily Immunoglobulin 5.49e-22
Family C2 set domains 0.000063
Further Details:      
 
Domain Number 3 Region: 224-310
Classification Level Classification E-value
Superfamily Immunoglobulin 4.18e-17
Family I set domains 0.026
Further Details:      
 
Domain Number 4 Region: 503-598
Classification Level Classification E-value
Superfamily Immunoglobulin 2.49e-16
Family I set domains 0.058
Further Details:      
 
Domain Number 5 Region: 31-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000047
Family I set domains 0.0000119
Further Details:      
 
Domain Number 6 Region: 309-404
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000168
Family I set domains 0.00013
Further Details:      
 
Domain Number 7 Region: 592-686
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000311
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003220   Gene: ENSGGOG00000003275   Transcript: ENSGGOT00000003294
Sequence length 739
Comment pep:novel chromosome:gorGor3.1:1:103441049:103461931:1 gene:ENSGGOG00000003275 transcript:ENSGGOT00000003294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIRKLLVCRAKLHIDEMDSVPTERRAVKELQVYISPKDTVISVNPSTKLQEGG
SVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGDLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSMQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSGKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENSKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV
Download sequence
Identical sequences G3QL75
ENSGGOP00000003220 ENSGGOP00000003220 XP_004026248.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]