SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003948 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003948
Domain Number 1 Region: 24-129
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-18
Family V set domains (antibody variable domain-like) 0.00000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003948   Gene: ENSGGOG00000004023   Transcript: ENSGGOT00000004045
Sequence length 219
Comment pep:novel chromosome:gorGor3.1:2a:88354460:88357625:-1 gene:ENSGGOG00000004023 transcript:ENSGGOT00000004045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPVTALLLPLALLLHAARPSQFRVWPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN
YIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIVSQPLSLRPEACRPAAGGAVHTRGLDFA
CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPR
Download sequence
Identical sequences ENSGGOP00000003948 ENSGGOP00000003948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]