SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004795 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004795
Domain Number 1 Region: 71-138
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 229-273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000119
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004795
Domain Number - Region: 135-176
Classification Level Classification E-value
Superfamily FnI-like domain 0.000136
Family VWC domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004795   Gene: ENSGGOG00000004894   Transcript: ENSGGOT00000004918
Sequence length 375
Comment pep:novel chromosome:gorGor3.1:6:112221476:112238102:1 gene:ENSGGOG00000004894 transcript:ENSGGOT00000004918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKRRLLYPSGWLHGPSDMQGLLFSTLLLAGLAQQMKFCCRVQGTGPLDTTPEGRPGEVS
DAPQRKQFCHWPCKCPHQKPRCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLY
CDYSVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPK
LAGSHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPC
SRTCGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKAEK
FVFSGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQR
NCREPGDIFSELKIL
Download sequence
Identical sequences ENSGGOP00000004795 ENSGGOP00000004795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]