SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005256 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005256
Domain Number 1 Region: 29-141
Classification Level Classification E-value
Superfamily FKBP-like 4.91e-41
Family FKBP immunophilin/proline isomerase 0.000000895
Further Details:      
 
Domain Number 2 Region: 256-416
Classification Level Classification E-value
Superfamily TPR-like 8.6e-33
Family Tetratricopeptide repeat (TPR) 0.0000000603
Further Details:      
 
Domain Number 3 Region: 142-253
Classification Level Classification E-value
Superfamily FKBP-like 1.83e-26
Family FKBP immunophilin/proline isomerase 0.000000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005256   Gene: ENSGGOG00000005367   Transcript: ENSGGOT00000005393
Sequence length 457
Comment pep:novel chromosome:gorGor3.1:6:36557004:36627165:-1 gene:ENSGGOG00000005367 transcript:ENSGGOT00000005393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDEGAKNNGESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRM
FDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEANKAMGKKTSEGVTNEKGTDSHAMEEEKPEGHV
Download sequence
Identical sequences ENSGGOP00000005256 ENSGGOP00000005256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]