SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005422 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005422
Domain Number 1 Region: 30-548
Classification Level Classification E-value
Superfamily ALDH-like 6.54e-122
Family ALDH-like 0.000000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005422   Gene: ENSGGOG00000005534   Transcript: ENSGGOT00000005565
Sequence length 564
Comment pep:novel chromosome:gorGor3.1:1:19460526:19492510:-1 gene:ENSGGOG00000005534 transcript:ENSGGOT00000005565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGR
TEAIPCVVGDEEVWTSDVLYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARREWDLKP
IADRAQIFLKAADMLSGPRRAEILAKTVRKQGGKTVIQAEIDAAAELIDFFRFNAKYAVE
LEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGTPALMGNVVLWKPSDTAM
LASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKYLWKQVA
QNLDRFRTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHS
LWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGG
KCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLT
GAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYIL
RWTSPQVIKETHKPLGDWSYAYMQ
Download sequence
Identical sequences ENSGGOP00000021073 ENSGGOP00000005422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]