SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005663 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005663
Domain Number 1 Region: 276-536
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-52
Family Kelch motif 0.0000971
Further Details:      
 
Domain Number 2 Region: 17-117
Classification Level Classification E-value
Superfamily POZ domain 3.02e-31
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005663   Gene: ENSGGOG00000005779   Transcript: ENSGGOT00000005811
Sequence length 564
Comment pep:novel chromosome:gorGor3.1:7:23373008:23441936:1 gene:ENSGGOG00000005779 transcript:ENSGGOT00000005811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGGTDCRTFLTSHINLKKTLCDVILMVQERKIPAHRVVLAAASHFFNLMFTTNMLESKS
FEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDAANQYQIEPVKKMCVDFLKEQVD
ASNCLGISVLAECLDCPELKATADDFIHQHFTEVYKTDEFLQLDVKRVTHLLNQDTLTVR
AEDQVYDAAVRWLKYDEPNRQPFMVDILAKVRFPLISKNFLSKTVQAEPLIQDNPECLKM
VISGMRYHLLSPEDREELVDGTRPRRKKHDYRIALFGGSQPQSCRYFNPKDYSWTDIRCP
FEKRRDAACVFWDNVVYILGGSQLFPIKRMDCYNVVKDSWYSKLGPPTPRDSLAACAAEG
KIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQRCSHGMVEANGLIYVCGGSLGNN
VSGRVLNSCEVYDPATETYVSMCKLPKKKKKKSLIIKNDFINIIFGEESEGGLDNVEYYD
IKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVR
AFPVTSCLICVVDTCGANEETLET
Download sequence
Identical sequences ENSGGOP00000005663 ENSGGOP00000017324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]