SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006110 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006110
Domain Number 1 Region: 28-479
Classification Level Classification E-value
Superfamily Sema domain 1.14e-115
Family Sema domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1601-1728,1916-2102
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-46
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1067-1162
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000261
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 4 Region: 1159-1249
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000738
Family Other IPT/TIG domains 0.035
Further Details:      
 
Domain Number 5 Region: 482-533
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000222
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1249-1293,1323-1376
Classification Level Classification E-value
Superfamily E set domains 0.00000000000981
Family Other IPT/TIG domains 0.048
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006110
Domain Number - Region: 638-670
Classification Level Classification E-value
Superfamily Plexin repeat 0.0131
Family Plexin repeat 0.0081
Further Details:      
 
Domain Number - Region: 1026-1067
Classification Level Classification E-value
Superfamily Plexin repeat 0.0262
Family Plexin repeat 0.0037
Further Details:      
 
Domain Number - Region: 1391-1442
Classification Level Classification E-value
Superfamily E set domains 0.0857
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006110   Gene: ENSGGOG00000006231   Transcript: ENSGGOT00000006275
Sequence length 2135
Comment pep:novel chromosome:gorGor3.1:3:49646282:49671914:-1 gene:ENSGGOG00000006231 transcript:ENSGGOT00000006275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALGPALLQALWAGWVLTLQPLPPAAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSP
GLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCE
QRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQ
SRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSA
APPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDV
NSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVAMEDGHTIAF
LGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVA
SCAQHLDCASCLARRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLP
RGADYVSVSVELRFGTVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLC
THKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
ASDISPGASPSLLSPWGPWAGSGPISSPGSTESPLHEEPSPPSPQNGPGTAVPAPTDFRP
SATPEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKPALD
WLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDTPGL
WELEEATLGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLE
VVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLY
DCSVGHGDCSRCQTAMPQYGCVWCEGERPRCVTREACGEAEAVATQCPAPLIHSVEPLTG
PVDGGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLVCITGASGEEVAGA
TAVEVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVG
DQPCHLLPEQQSEQLQCETSPHPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPT
KSFLSGGREIWVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSS
QQFEEPCHVNSSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTL
QPLNPEDPTMPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPP
VEQPLPRHHVLREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLL
ALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLG
SGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFI
HTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTE
TVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLL
REDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDP
RTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRE
NQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLT
RLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNS
LPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYAR
DIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYYD
QIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences G3QTS7
ENSGGOP00000006110 XP_004034120.1.27298 XP_004034121.1.27298 XP_018879638.1.27298 XP_018879639.1.27298 ENSGGOP00000006110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]