SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006387 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006387
Domain Number 1 Region: 526-559,641-715
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000118
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006387   Gene: ENSGGOG00000006523   Transcript: ENSGGOT00000006557
Sequence length 763
Comment pep:novel chromosome:gorGor3.1:7:105436907:105478300:-1 gene:ENSGGOG00000006523 transcript:ENSGGOT00000006557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPFGNQYIVARPVYSTNAFEENHKKTERHHKTFLDHLKVCCSCSPQKAKRIVLSLFPI
ASWLPAYRLKEWLLSDIVSGISTGIVAVLQGSLAFALLVDIPPVYGLFASFFPAIIYFFF
GTSRHISVGPFPILSMMVGLAVSGAVSKAVPDRNATTSGLSNNSSNSSLLDDERVRVAAS
VTVLSGIIQLAFGILRIGFVVIYLSESLISGFTTAAAVHVLVSQLKFMFQLTIPSHTDPL
SIFKVLESVFSQIEKTNIADLVTALIVLLVVSIVKEINQRFKDKLPVPIPIEFIMTVIAA
GVSYGCDFKNRFKVAVVGDMNPGFQPPITPDVQTFQNTIGDCFGIAMVAFAVAFSVASVY
SLKYDYPLDGNQELIALGLGNIVCGVFRGFAGSTALSRSAVQESTGGKTQIAGLIGAIIV
LIVLLAIGFLLAPLQKSVLAALALGNLKGMLMQFTEIGRLWRKDKYDCLIWITTFIFTIV
LGLGLGLAASVAFQLLTIVFRTQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCP
SPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICAVDTI
KDSDEELDNNQIEVLDQPINTTDLPFQIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDV
SSMRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRCEFFDGEVKNSIFFLTIHDAVLHIL
MKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYQVPVETKF
Download sequence
Identical sequences ENSGGOP00000006387 ENSGGOP00000006387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]