SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008025 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008025
Domain Number 1 Region: 24-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000365
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 
Domain Number 2 Region: 823-914
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000589
Family V set domains (antibody variable domain-like) 0.012
Further Details:      
 
Domain Number 3 Region: 151-258
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000307
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 
Domain Number 4 Region: 412-534
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000379
Family V set domains (antibody variable domain-like) 0.052
Further Details:      
 
Domain Number 5 Region: 294-380
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000127
Family V set domains (antibody variable domain-like) 0.083
Further Details:      
 
Domain Number 6 Region: 682-788
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000256
Family V set domains (antibody variable domain-like) 0.053
Further Details:      
 
Domain Number 7 Region: 551-643
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000045
Family C1 set domains (antibody constant domain-like) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008025   Gene: ENSGGOG00000008209   Transcript: ENSGGOT00000008246
Sequence length 1021
Comment pep:novel chromosome:gorGor3.1:1:120102298:120135670:1 gene:ENSGGOG00000008209 transcript:ENSGGOT00000008246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGISYVASFFLFLTKLSIGQREVTVQKGPLFRAEGYPVSIGCNVTGHQGPSEQHFQWSV
YLPTNPTQEVQIISTKDAAFSYAVYTQRVRSGDIYVERVQGNSVLLHISKLQMKDAGEYE
CHTPNTDEKYYGSYSAKTNLIVIPDTLSATMSSQTLGKEEGEPLALTCEASKATAQHTHL
SVTWYLTQDGGGSQATEIISLSKDFILVPGPLYTERFVASDVQLNKLGPTTFRLSIERLQ
SSDQGQLFCEATEWIQDPDETWMFITKKQTDQTTLRIQPAVKDFQVNITADSLFAEGKPL
ELVCLVVGSSRDPQLQGIWFFNGTEIAHIDAGGVLGLKNDYKERASQGELQVSKLGPKAF
SLKIFSLGPEDEGAYRCVVAEVMKTRTGSWQVLQRKQSPDSHVHLRKPAARSVVVSTKNK
QQVVWEGETLAFLCKAGGAESPLSVSWWHIPRDQTQPKFVAGMGQDGIVQLGASYGGPSY
HGNTRLEKMDWATFQLEITFTAITDSGTYECRVSEKSRNQARDLSWTQKISVTVKSLESS
LQVSLMSRQPQVMLTNTFDLSCVVRAGYSDLKVPLTVTWQFQPASSHIFHQLIRITHNGT
IEWGNFLSQFQKKTKVSQSLFRSQLLVHDATEEETGVYQCEVEVYDRNSLYNNRPPRASA
ISHPLRIAVTLPESKLKVNSRSQVQELSINSNTDIECSILSRSNGNLQLAIIWYFSPVST
NASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKISQDLFQLHILNVEDSDQGKYHCAV
EEWLLSTNGTWHKLGEKKSGLTELKLKPTGSKVRVSKVYWTENVTEHREVAIRCSLESVG
SSATLYSVMWYWNRENSGSKLLVHLQHDGLLEYGEEGLRRHLHCYRSSSTDFVLKLHQVE
MEDAGMYWCRVAEWQLHGHPSKWINQASDESQRMALTVLPSEPTLPSRICSSAPLLYFLF
ICPFVLLLLLLISLLCLHWKARKLSTLRSNTRKEKALWVDLKEAGGVTANRREDEEEDEG
N
Download sequence
Identical sequences G3QYT3
ENSGGOP00000008025 ENSGGOP00000008025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]