SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008242 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008242
Domain Number 1 Region: 2-135
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.91e-37
Family G proteins 0.0000448
Further Details:      
 
Domain Number 2 Region: 143-181
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000759
Family SOCS box-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008242   Gene: ENSGGOG00000008437   Transcript: ENSGGOT00000008471
Sequence length 232
Comment pep:novel chromosome:gorGor3.1:5:467504:473661:1 gene:ENSGGOG00000008437 transcript:ENSGGOT00000008471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGIDYKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGID
RWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITES
FTELARIVLLRHGMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFS
MANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS
Download sequence
Identical sequences ENSGGOP00000008242 ENSGGOP00000008242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]