SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008427 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008427
Domain Number 1 Region: 123-215
Classification Level Classification E-value
Superfamily Immunoglobulin 3.34e-20
Family I set domains 0.033
Further Details:      
 
Domain Number 2 Region: 44-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000182
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008427   Gene: ENSGGOG00000008620   Transcript: ENSGGOT00000008659
Sequence length 262
Comment pep:novel chromosome:gorGor3.1:5:53985334:54003121:1 gene:ENSGGOG00000008620 transcript:ENSGGOT00000008659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWKSSVIMQMGRFLLLVILFLPREMTSSVLTVNGKTENYILDTTPGSQASLICAVQNHT
REEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSISVVLNVT
FPPLLSGNDFQTVEEGSNVKLVCSVKANPQAQMMWYKNSSLLDLEKSHHQIQQTSESFQL
SIIKVEKSDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVPIEPIIAACVVIFLTLCFGLI
ARRKKIMKLCMKDKDPHSETAL
Download sequence
Identical sequences G3QZV8
ENSGGOP00000008427 ENSGGOP00000008427 XP_004042040.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]