SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008586 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008586
Domain Number 1 Region: 1064-1158
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-23
Family I set domains 0.0033
Further Details:      
 
Domain Number 2 Region: 776-869
Classification Level Classification E-value
Superfamily Immunoglobulin 2.89e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 129-223
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 872-966
Classification Level Classification E-value
Superfamily Immunoglobulin 1.86e-20
Family I set domains 0.0079
Further Details:      
 
Domain Number 5 Region: 1160-1247
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-19
Family I set domains 0.0066
Further Details:      
 
Domain Number 6 Region: 968-1062
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-19
Family I set domains 0.0039
Further Details:      
 
Domain Number 7 Region: 418-505
Classification Level Classification E-value
Superfamily Immunoglobulin 7.99e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 320-415
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 224-318
Classification Level Classification E-value
Superfamily Immunoglobulin 6.22e-17
Family I set domains 0.0092
Further Details:      
 
Domain Number 10 Region: 683-773
Classification Level Classification E-value
Superfamily Immunoglobulin 3.16e-16
Family I set domains 0.0044
Further Details:      
 
Domain Number 11 Region: 36-125
Classification Level Classification E-value
Superfamily Immunoglobulin 6.64e-16
Family I set domains 0.0076
Further Details:      
 
Domain Number 12 Region: 589-680
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000317
Family I set domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008586   Gene: ENSGGOG00000008773   Transcript: ENSGGOT00000008821
Sequence length 1336
Comment pep:novel chromosome:gorGor3.1:X:128777662:128793537:-1 gene:ENSGGOG00000008773 transcript:ENSGGOT00000008821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRPGEGATMLKTFTVLLFCIRMSLGMTSIVMDPQPELWIESNYPQAPWENITLWCRS
PSRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKV
LELEAPGQLPKPIFWIQAETPPLPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGT
MAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAHPGPIMAP
GESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYD
ASYRGSLLSDVLKIWVTDTFPKTWLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGED
KPLQFLDATSIDDNTSFFLNNVTYSDTGIYSCHYLLSWKTSIRMPSHNTVELMVVDKPPK
PSLSAWPSTVFKLGKAITLQCRVSHPVLEFSLEWEERETFQKFSVNGDFIISNVDGKGTG
TYSCSYRVETHPNIWSHRSEPLKLMGPAGYLTWNYVLNEAIRLSLIMQLVALLLVVLWIR
WKCRRLRIREAWLLGTAQGVTMLFTVTALLCCGLCNGVLIEETEIVMPTPKPELWAETNF
PLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHC
HSWEEMAVSEPSEALELVGTDILPKPVISASPPIRGQELQLRCKGWLAGMGFALYKEGEQ
EPVQQLGAIGREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMYPKPF
FKTWASPVVTPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFLIISVG
IGDGGNYSCRYYDFSIWSEPSDPVELVVTEFYPKPTLLAQPGPVVFPGKSVILRCQGTFQ
GMRFALLQEGAHFPLQFRSVSGNSADFLLHTVGAEDSGNYSCIYYETTMSNRGSYLSMPL
MIWVTDTFPKPWLFAEPSSVVPMGQNVTLWCRGPVHGVGYILHKEGEATSMQLWGSTSND
GVFPITNISGASMGRYSCCYHPDWTSSIKIQPSNTLELLVTGLLPKPSLLAQPGPMVAPG
ENMTLQCQGELPDSTFVLLKEGAQEPLEQQRPSGYRADFWMPAVRGEDSGIYSCVYYLDS
APFAASNHSDSLEIWVTDKPPKPSLSAWPSTMFKLGKDITLQCRGPLPGVEFVLEHDGEE
APQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDPLELVGAAGPVAQECTVG
NIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGEPGTPGNS
PSSTSQRISVELPVPI
Download sequence
Identical sequences ENSGGOP00000008586 ENSGGOP00000008586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]