SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008663 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008663
Domain Number 1 Region: 21-286
Classification Level Classification E-value
Superfamily L domain-like 8.93e-43
Family Ngr ectodomain-like 0.0066
Further Details:      
 
Domain Number 2 Region: 284-376
Classification Level Classification E-value
Superfamily Immunoglobulin 6.32e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 419-497
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000106
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008663   Gene: ENSGGOG00000008864   Transcript: ENSGGOT00000008900
Sequence length 735
Comment pep:novel chromosome:gorGor3.1:6:41556179:41751879:-1 gene:ENSGGOG00000008864 transcript:ENSGGOT00000008900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLLGGLLAFGMAFAVVDACPKYCVCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLG
GNFIIHISRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTL
RGLVNLQHLIVNNNQLGGIADEAFEDFLLTLEDLDLSYNNLHGLPWDSVRRMVNLHQLSL
DHNLLDHIAEGTFADLQKLARLDLTSNRLQKLPPDPIFARSQASALTATPFAPPLSFSFG
GNPLHCNCELLWLRRLERDDDLETCGSPGGLKGRYFWHVREEEFVCEPPLITQHTHKLLV
LEGQAATLKCKAIGDPSPLIHWVAPDDRLVGNSSRTAVYDNGTLDIFITTSQDSGAFTCI
AANAAGEAMATVEVSIVQLPHLSNSTSRTAPPKSRLSDITGSSKTSRGGGGSGGGEPPKS
PPERAVLVSEVTTTSALVKWSVSKSAPRVKMYQLQYNCSDDEVLIYRMIPASNKAFVVNN
LVSGTGYDLCVLAMWDDTATTLTATNIVGCAQFFTKADYPQCQSMHSQILGGTMILVIGG
IIVATLLVFIVILMVRYKVCNHEAPSKMAAAVSNVYSQTNGTQPPPPSSAPAGAPPQGPP
KVVVRNELLDFTASLARASDSSSSSSLGSGEAAGLGRAPWRLPPSAPRPKPSLDRLMGAF
ASLDLKSQRKEELLDSRTPAGGVVPGGYSPPRKVSNIWTKRSLSVNGMLLPFEESDLVGA
RGTFGSSEWVMESTV
Download sequence
Identical sequences ENSGGOP00000008663 ENSGGOP00000008663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]