SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009163 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009163
Domain Number 1 Region: 11-200
Classification Level Classification E-value
Superfamily E set domains 1.9e-78
Family RhoGDI-like 0.0000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009163   Gene: ENSGGOG00000009374   Transcript: ENSGGOT00000009417
Sequence length 201
Comment pep:novel chromosome:gorGor3.1:12:15107012:15126650:-1 gene:ENSGGOG00000009374 transcript:ENSGGOT00000009417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVT
DPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIV
SGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTD
DDKQDHLSWEWNLSIKKEWTE
Download sequence
Identical sequences A0A024RAS5 A0A2J8SQS3 G1QV75 G3R1T1 H2Q5I9 P52566
ENSP00000228945 ENSP00000440560 ENSP00000444860 ENSP00000228945 NP_001166.3.87134 NP_001166.3.92137 NP_001308349.1.87134 NP_001308349.1.92137 NP_001308350.1.87134 NP_001308350.1.92137 NP_001308351.1.87134 NP_001308351.1.92137 NP_001308352.1.87134 NP_001308352.1.92137 XP_003265593.1.23891 XP_003265594.1.23891 XP_004052845.1.27298 XP_004092153.1.23891 XP_004092154.1.23891 XP_004092155.1.23891 XP_004092156.1.23891 XP_008967803.1.60992 XP_009423189.1.37143 XP_009423190.1.37143 XP_012357839.1.23891 ENSP00000228945 ENSP00000440560 ENSP00000444860 gi|56676393|ref|NP_001166.3| ENSGGOP00000009163 9598.ENSPTRP00000008071 9606.ENSP00000228945 ENSNLEP00000004845 ENSPTRP00000008071 ENSPTRP00000008071 ENSGGOP00000009163 ENSNLEP00000004845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]