SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010311 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010311
Domain Number 1 Region: 29-64,101-176
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000482
Family V set domains (antibody variable domain-like) 0.022
Further Details:      
 
Domain Number 2 Region: 172-267
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000123
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010311   Gene: ENSGGOG00000010576   Transcript: ENSGGOT00000010615
Sequence length 423
Comment pep:novel chromosome:gorGor3.1:X:105437319:105469938:1 gene:ENSGGOG00000010576 transcript:ENSGGOT00000010615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFAFWKVFLILSCLAGQVSVVQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWS
FFHKKEMEPISHSSCLSTEGMEEKAVSQCLKMTHARDARGRCSWTSEIYFSQGGQAVAIG
QFKDRITGSSDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGVLNVSVLVKPSKPL
CSIQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNF
EQGYYQCTAINRLGNSSCEIDLTSSHPEVGIIVGALIGSLVGAAIIISVVCFARNKAKAK
AKERNSKTIAELEPMTKINPRGESEAMPREDATQLEVTLPPSIHETGPDTIQEPDYEPKP
TQEPAPESATGSEPMAVPDLDIELELEPETQSELEPEPEPEPESEPGVVVEPLSEDEKGV
VKA
Download sequence
Identical sequences G3RZ93
XP_004064737.1.27298 ENSGGOP00000021136 ENSGGOP00000010311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]