SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010971 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010971
Domain Number 1 Region: 233-304,433-500
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000332
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 127-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000699
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 32-133
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000105
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010971   Gene: ENSGGOG00000011249   Transcript: ENSGGOT00000011295
Sequence length 714
Comment pep:novel chromosome:gorGor3.1:19:48670834:48679125:-1 gene:ENSGGOG00000011249 transcript:ENSGGOT00000011295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKLSAQSPESKFSAETHSAASFPQQVGGPLAVLVGTTIRLPLVPIPNPGPPTSLVVWR
RGSKVLAAGGLGPGAPLISLDPAHRDHLRFDQARGVLELASAQLDDAGVYTAEIIRAGVS
RQTREFTVVVYEPLPQLSVQPKAPETEEGAAELRLRCLGWGPGRGELSWSRDGRALEAAE
SEGAETPRIRSEGDQLLIVRPVRSDHARYTCCVRSPFGHREAAADVSVFYGPDPPTITVS
SDRDAAPSHFVTAGSNVTLRCAAASRPPADITWSLADPAEAAVPAGSRLLLPAVGPGHAG
TYACLAANPRTGRRRRSLLNLTVADLPPGAPQCSVEGGPGDRSLRFRCSWPGGAPAASLQ
FQGLPEGIRAGPVSSVLLAAVPAHPRLSGVPITCLARHLVATRTCTVTPEAPREVLLHLL
VAETGLGEAEVALEASGCPPPSRASWAREGRPLAPGGGSRLRLSQDGRKLHIGNFSLDWD
LGNYSVLCSGALGAGGDQITLIGPSISSWRLQRARDAAVLTWDVERGALISSFEIQAWPD
GPALGRTSTYRDWVSLLILGPQERSAVVPLPPRNPGTWTFRILPILGGQPGTPSQSRVYR
AGPTLSHGAIAGIVLGSLLGLALLAVLLLLCICCLCRFRGKTPEKKKHPSTLVPVVTPSE
KKMHSVTPVEISWPLDLKVPLEDHSSTRAYQATDPSSVVSVGGGSKTVRAATQV
Download sequence
Identical sequences ENSGGOP00000010971 ENSGGOP00000022700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]