SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012659 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012659
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Immunoglobulin 3.19e-33
Family V set domains (antibody variable domain-like) 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012659   Gene: ENSGGOG00000012977   Transcript: ENSGGOT00000013024
Sequence length 105
Comment pep:novel chromosome:gorGor3.1:2a:90816822:90817136:1 gene:ENSGGOG00000012977 transcript:ENSGGOT00000013024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIVMTQTPLSLPVNPGQLASISCRSSQSLLHSNGYTYLHWYLQKPGKSPQLLIYRVSSHF
SGVPDRFSGSGSGSDFTLKISWVEAEDVGVYYCMQATQFPNTVVQ
Download sequence
Identical sequences ENSGGOP00000012659 ENSGGOP00000012659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]