SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013251 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013251
Domain Number 1 Region: 547-579,718-792
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000644
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013251   Gene: ENSGGOG00000013580   Transcript: ENSGGOT00000013632
Sequence length 971
Comment pep:novel chromosome:gorGor3.1:6:36938436:37014197:-1 gene:ENSGGOG00000013580 transcript:ENSGGOT00000013632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLERRAISGFSSKSRRNSFAYDVKREVYNEETFQQEHKRKASSSGNMNINITTFRHHV
QCRCSWHRFLRCMLTIFPFLEWMCMYRLKDWLLGDLLAGISVGLVQVLQGLTLSLLARQL
IPPLNIAYAAFCSSVIYVIFGSCHQMSIGEITITEARLIKGHTISTFTSHRIALSRGLMH
AFSSPSSLSFFHLKKGVMKFNLFKTLYIELIMGVLGLGFIATYLPESAMSAYLAAVALHI
MLSQLTFIFGIMISFHAGPISFFYDIINYCVALPKANSTSILLFLTVVVALRINKCIRIS
FNQYPIEFPMELFLIIGFTVIANKISMATETSQTLIDMIPYSFLFPVTPDFSLLPKIILQ
AFSLSLVSSFLLIFLGKKIASLHNYSVNSNQDLIAIGLCNVVSSFFRSCVFTGAIARTII
QDKSGGRQQFASLVGAGVMLLLMVKMGHFFYTLPNIIPNGCSSLSLVPFIQNNSIWIPGL
RVKDRGDQALWMMTFSSSIFLGLDIGLIISVVSAFFITTVRSHRAKILLLGQIPNTNIYR
SISDYREIITIPGVKIFQCCSSITFVNVYYLKHKLLKEVDMVKVPLKEEEIFSLFNSSDT
NLQGGKICRCFCNCDDLEPLPRILYTERFENKLDPEASSVNLIHCSHFESMNTSQTASED
QVPYTVSSVSQKNQGQQYEEVEEVWLPNNSSRNSSPGLPDVAESQGRRSLIPYSDASLLP
SVHTIILDFSMVHYVDSRGLVVLRQICNAFQNANILILIAGCHSSIVRAFERNDFFDAGI
TKTQLFLSVHDAVLFALSRKVIGSSELSIDESETVIRETYSETDKNDNSRYKMSSSFLGS
QKNVSPGFIKIQQPVEEESKLDLELESEQEAGLGLDLDLDRELEPKMEPKAETETKTQTE
MEPQPETEPEMEPNSKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTQTWSVERRRHPMDS
YSPEGNSNEDV
Download sequence
Identical sequences ENSGGOP00000013251 ENSGGOP00000013251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]