SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014347 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014347
Domain Number 1 Region: 885-1086
Classification Level Classification E-value
Superfamily Fibronectin type III 1.5e-42
Family Fibronectin type III 0.00000822
Further Details:      
 
Domain Number 2 Region: 1330-1509
Classification Level Classification E-value
Superfamily Fibronectin type III 4.3e-33
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 1096-1235
Classification Level Classification E-value
Superfamily Fibronectin type III 7.23e-31
Family Fibronectin type III 0.00097
Further Details:      
 
Domain Number 4 Region: 308-385,428-502
Classification Level Classification E-value
Superfamily Immunoglobulin 3.13e-25
Family I set domains 0.044
Further Details:      
 
Domain Number 5 Region: 688-786
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-21
Family I set domains 0.04
Further Details:      
 
Domain Number 6 Region: 224-312
Classification Level Classification E-value
Superfamily Immunoglobulin 6.03e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 7 Region: 1236-1335
Classification Level Classification E-value
Superfamily Immunoglobulin 6.53e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 8 Region: 596-692
Classification Level Classification E-value
Superfamily Immunoglobulin 5.14e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 9 Region: 787-890
Classification Level Classification E-value
Superfamily Immunoglobulin 4.32e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 10 Region: 507-599
Classification Level Classification E-value
Superfamily Immunoglobulin 2.21e-17
Family I set domains 0.04
Further Details:      
 
Domain Number 11 Region: 127-220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000565
Family I set domains 0.058
Further Details:      
 
Domain Number 12 Region: 35-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000766
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014347   Gene: ENSGGOG00000014691   Transcript: ENSGGOT00000014758
Sequence length 1963
Comment pep:novel chromosome:gorGor3.1:21:28580032:29463894:-1 gene:ENSGGOG00000014691 transcript:ENSGGOT00000014758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWILALSLFQSFANVFSEDLHSSLYFVNASLQEVVFASTTGTLVPCPAAGIPPVTLRWYL
ATGEEIYDVPGIRHVHPNGTLQIFPFPPSSFSTLIHDNTYYCTAENPSGKIRSQDVHIKA
VLREPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYITVVSWEKDTVSLVSGSRFLITSTGA
LYIKDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRKAMAGQ
RVELPCKALGHPEPDYRWLKDNMPLELSGRFQKTVTGLLIENIRPSDSGSYVCEVSNRYG
TAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGTEDQELSWYRNGEILNPGKNV
RITGINHENLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVLEDGTPKIISAFSEKVVSP
AEPVSLMCNVKGTPLPTITWTLDDDPILKGGSHRISQMITSEGNVVSYLNISSSQVRDGG
VYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKN
SNLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFIQ
PFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPGSLGVTIDNIDFTSSLRISNLS
LMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPT
IVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSM
YLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRWEKEDRIINPEMARYLVSTK
EVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPPEIEIKDVKART
ITLRWTMGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRM
YAKNRIGKSEPSNELTITADEAAPDGPPQEVHLEPISSQSIRVTWKAPKKHLQNGIIRGY
QIGYREYSTGGNFQFNIISVDTSGDSEVYTLDNLNKFTQYGLVVQACNRAGTGPSSQEII
TTTLEDELGEIKNITTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVP
GPPAGVKAAAASASMVFVSWLPPLKLNGIIRKYTVFCSHPYPTVISEFEASPDSFSYRIP
NLSRNRQYSVWVVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKA
VGDPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYSCIANNNWGSDE
IVLNLQVQVPPDQPRLTVSKTTSSSITLSWLPGDNGGSSIRGYILQYSEDNSEQWGSFPI
SPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINT
TRVRLNLIGWNDGGCPITSFTLEYRPFGTTVWTTAQRTSLSKSYILYDLQEATWYELQMR
VCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLVTISCILVGVLLL
FVLLLVVRRRRREQRLKRLRDAKSLAEMLMSKNTRTSDTLSKQQQTLRMHIDIPRAQLLI
EERDTMETIDDRSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTN
PTTRRNAKAGPTARNRYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVS
PSQDTDRARSSMVSTESASSTYEELARAYEHAKMEEQLRHAKFTITECFISDTSSEQLTA
GTNEYTDSLTSSTPSESGICRFTASPPKPQDGGRVMNMAVPKAHRPGDLIHLPPYLRMDF
LLNRGGPGTSRDLSLGQACLEPQKSRTLKRPTVLEPIPMEAASSASSTREGQSWQPGAVA
TLPQREGAELGQAAKMSSSQESLLDSRGHLKGNNPYAKSYTLV
Download sequence
Identical sequences ENSGGOP00000014347 ENSGGOP00000014347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]