SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014473 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000014473
Domain Number - Region: 36-89
Classification Level Classification E-value
Superfamily FnI-like domain 0.00314
Family Fibronectin type I module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014473   Gene: ENSGGOG00000014834   Transcript: ENSGGOT00000014886
Sequence length 114
Comment pep:known chromosome:gorGor3.1:10:61976970:61990042:1 gene:ENSGGOG00000014834 transcript:ENSGGOT00000014886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVLPGSLVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLEGNKHPINSEWQTDNCETC
TCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Download sequence
Identical sequences G3RFU4
ENSGGOP00000014473 ENSGGOP00000014473 XP_004049458.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]