SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015526 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015526
Domain Number 1 Region: 30-525
Classification Level Classification E-value
Superfamily Sema domain 8.76e-160
Family Sema domain 0.000000000193
Further Details:      
 
Domain Number 2 Region: 521-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000012
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 590-673
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000014
Family V set domains (antibody variable domain-like) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015526   Gene: ENSGGOG00000015913   Transcript: ENSGGOT00000015971
Sequence length 782
Comment pep:novel chromosome:gorGor3.1:3:53777292:53788788:-1 gene:ENSGGOG00000015913 transcript:ENSGGOT00000015971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSAWAICWLLGGLLLHGGSSGPSPGPSVPRLRLSYRDLLSANRSAIFLGPQGSLNLQA
MYLDEYRDRLFLGGLDALYSLRLDQAWPDPREVLWPPQPGQREECVRKGRDPLTECANFV
RVLQPHNRTHLLACGTGAFQPTCALITVGHRGEHVLQLEPGSVESGRGRCPHEPSRPFAS
TFIDGELYTGLTADFLGREAMIFRSGGPRPALRSDSDQSLLHDPRFVMATRIPENSDQDN
DKVYFFFSETVPSPDGGSNHVTVSRVGRVCVNDAGGQRVLVNKWSTFLKARLVCSVPGPG
GAETHFDQLEDVFLLWPKAGKSLEVYALFSTVSAVFQGFAVCVYHMADIWEVFNGPFAHR
DGPQHQWGPYGGKVPFPRPGVCPSKMTTQPGRPFGSTKDYPDEVLQFARAHPLMFWPVRP
RHGRPVLVKTHLAQQLHQIVVDRVEAEDGTYDVIFLGTDSGSVLKVIALQAGGSAEPEEV
VLEELQVFKVPTPITEMEISVKRQMLYVGSRLGVAQLRLHQCETYGTACAECCLARDPYC
AWDGASCTHYRPSLGKRRFRRQDIRHGNPALQCLGQSQEEEAVGLVAATMVYGTEHNSTF
LECLPKSPQAAVRWLLQRPGDEGPDQVKTDERVLHTERGLLFRRLSRFDAGTYTCTTLEH
GFSQTVVRLALVVIVASQLDNLFPPEPKPEEPPARGGLASTPPKAWYKDILQLIGFANLP
RVDEYCERVWCRGTTECSGCFRSRSRGKQARGKSWAGLELGKKMKSRVHAEHNRTPREVE
AT
Download sequence
Identical sequences G3RIL7
ENSGGOP00000015526 ENSGGOP00000015526 XP_004034330.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]