SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016372 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016372
Domain Number 1 Region: 93-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000223
Family I set domains 0.052
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016372
Domain Number - Region: 298-339
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0683
Family TNF receptor-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016372   Gene: ENSGGOG00000016780   Transcript: ENSGGOT00000016836
Sequence length 351
Comment pep:novel chromosome:gorGor3.1:7:51050361:51213613:-1 gene:ENSGGOG00000016780 transcript:ENSGGOT00000016836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAYALGPARQGRRRTRAAGSLLSQAAILLFISAFLVRVPSSVGHLVRLPRAFRLTKDSV
KIVGSTSFPVKAYVMLHQKSPHVLCVTQQLRNAELIDPSFQWYGPKGKVVSVENRTAQIT
STGSLVFQNFEESMSGIYTCFLEYKPTVEEIVKHLQLKYAIYAYREPHYYYQFTARYHAA
PCNSIYNISFEKKLLQILSKLLLDLSCEISLLKSECHRVKMQRAGLQNELFFAFSVSSLD
TEKGPKPCTDHNCEPYKRLFKAKNLIERFFNQQVEILGRRAEQLPQIYYIEGTLQMVWIN
RCFPGYGMNVQQHPKCPECCVICSPGSYNPRDGIHCLQCNSSLVYGAKTCL
Download sequence
Identical sequences ENSGGOP00000016372 ENSGGOP00000016372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]