SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017158 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000017158
Domain Number - Region: 17-62
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000118
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017158   Gene: ENSGGOG00000027683   Transcript: ENSGGOT00000033325
Sequence length 197
Comment pep:novel chromosome:gorGor3.1:19:48600820:48606232:1 gene:ENSGGOG00000027683 transcript:ENSGGOT00000033325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLLQLVHAKLLNSSCSLEKTLQCSCSFHGIPTPSVQWWMGGVPVGVDGMDGSLQVTST
MLGPWANSTISLTEEPEMGMRLLCEGKNQNRTHALSILLMSSEGGAAAQAFVKGLIQGAI
YAGIVIALLFLCLLPLIVKHIRKKQVKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVV
ATFSESRILEKQDKRAS
Download sequence
Identical sequences ENSGGOP00000017158 ENSGGOP00000017158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]