SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017207 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017207
Domain Number 1 Region: 35-145
Classification Level Classification E-value
Superfamily Immunoglobulin 1.88e-17
Family V set domains (antibody variable domain-like) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017207   Gene: ENSGGOG00000026682   Transcript: ENSGGOT00000033932
Sequence length 231
Comment pep:novel chromosome:gorGor3.1:1:208714224:208716103:1 gene:ENSGGOG00000026682 transcript:ENSGGOT00000033932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTCDREAFLSICFVTLVFPQLPLASIWKADFDVVGPHAPILAMAGGHVELQCQLFPNI
SAEDMELRWYRCQPSLAVHMHERGMDMDGEQKWQYRGRTTFMSDHVARGKAMVRSHRVTT
FDNGTYCCRFKDGVKFGEDTVQVQVAGLGTERRIQVTDQQDGVRAECTSAGCFPKSWVER
RDFRGQARPAVTNLSASAPTRLWAVASSLTLWDRAVEGLSCSISSPLLPER
Download sequence
Identical sequences ENSGGOP00000017207 ENSGGOP00000019353 ENSGGOP00000017207 ENSGGOP00000019353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]