SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017418 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017418
Domain Number 1 Region: 657-788,851-917
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.66e-38
Family Hemopexin-like domain 0.00092
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000157
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000131
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017418   Gene: ENSGGOG00000022953   Transcript: ENSGGOT00000028831
Sequence length 917
Comment pep:novel chromosome:gorGor3.1:1:165916209:165932008:1 gene:ENSGGOG00000022953 transcript:ENSGGOT00000028831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWKTLPIYLLLLLSVFVIQQVSSQDLSSCAGRCGEGYSRDAICNCDYNCQHYMECCPDF
KRVCTVELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAP
PPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITEEHSVSENQATIRKIKSSKNSAANR
ELQKKLKVKDNKKNRTKKKPTPKPPVVDEAGSGLDNGDFKVTTPDTSTTQHNKVTTSPKI
TTAKPINPRPSLPPNSDTPKETSLTVNKETTVETKETTTTNKQTSTDGKEKTTSAKETQS
IEKTSAKDLAPTSKVLAKPTPKAETTTKGPALTTPKEPTPTTPKEPAPTTPKKPAPTTPE
TPPPTTSEVSTPTTTKEPTTIHKSPDESTPELSAEPTPKALENSPKEPGVPTTKTPAATK
PEMTTTAKDKTTERDLRTTPETTTAAPKMTKETATTTEKTTESKITTTTTQVTSTTTQDT
TPFKITTLKTTTLAPKVTTTTKKTITTTEIMNKPEETAKPKDRATNSKATTPKPQKPTKA
PKKPTSTKKPKTMPRVRKPKTTPTPRKMTSTMPELNPTSRVAEAMLQTTTRPNQIPNSKL
VEVNPKSEDAGGAEGETPHMLLRPHVFMPEVTPDMDYLRRVPNQGIIINPMLSDETNICN
GKPVDGLTTLRNGTLVAFRGHYFWMLSPFSPPSPARRITEVWGIPSPIDTVFTRCNCEGK
TFFFKDSQYWRFTNDIKDAGYPKPIFKGFGGLTGQIVAALSTAKYKNWPESVYFFKRGGS
IQQYIYKQEPVQKCPGRRPALNYPVYGETTQVRRRRFERAIGPSQTHTIRIQYSPARLAY
HDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARA
ITTRSGQTLSKVWYNCP
Download sequence
Identical sequences ENSGGOP00000017418 ENSGGOP00000017418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]