SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017983 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017983
Domain Number 1 Region: 10-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.91e-45
Family G proteins 0.000024
Further Details:      
 
Domain Number 2 Region: 189-227
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000379
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017983   Gene: ENSGGOG00000023173   Transcript: ENSGGOT00000030282
Sequence length 277
Comment pep:novel chromosome:gorGor3.1:X:100724606:100744501:-1 gene:ENSGGOG00000023173 transcript:ENSGGOT00000030282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPGSPDQAYDFLLKFLLVGDSDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDG
QRVKLKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIDEHAPGVP
KILVGNRLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRM
NWLGRPSKVISLQDLCCRAIVSCTPVHLVDKLPLPITLRSHLKSFSMAKGLNARMMQGLS
YSLTTSSTHKSSLCKVEIVCPPQSPPKNCTRNSCKIS
Download sequence
Identical sequences ENSGGOP00000017983 XP_018874369.1.27298 ENSGGOP00000017983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]