SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018220 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018220
Domain Number 1 Region: 206-323
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.36e-37
Family Eukaryotic proteases 0.0018
Further Details:      
 
Domain Number 2 Region: 110-213
Classification Level Classification E-value
Superfamily SRCR-like 5.49e-18
Family Hepsin, N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018220   Gene: ENSGGOG00000026807   Transcript: ENSGGOT00000023519
Sequence length 325
Comment pep:novel chromosome:gorGor3.1:11:111522609:111541207:-1 gene:ENSGGOG00000026807 transcript:ENSGGOT00000023519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLMLDDQPPVEAQYAEEGPGPGIFRAEPGDQQHPISQVVCWRSMRRGCAVLGALGLLAG
AGVGSWLLVLYLCPAASQPISGTLQDQEITLSCSEASAEEALLPALPKTVSFRINSEDFL
LEVQVRDRPRWLLVCHEGWSPALGLQICWSLGHLRLTHHKGVNLTDIKLNSSQEFAQLSP
RLGGFLEEAWQPRNNCTSGRVVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFR
HTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLVSHSAVRPHQGAVVERIIPHPLY
SAQNHDYDVALLRLRTPLNFSDSLL
Download sequence
Identical sequences ENSGGOP00000018220 ENSGGOP00000018220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]