SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019008 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019008
Domain Number 1 Region: 432-567
Classification Level Classification E-value
Superfamily TIMP-like 3.61e-30
Family Netrin-like domain (NTR/C345C module) 0.039
Further Details:      
 
Domain Number 2 Region: 209-304
Classification Level Classification E-value
Superfamily Immunoglobulin 2.53e-20
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 385-437
Classification Level Classification E-value
Superfamily BPTI-like 8.8e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 324-380
Classification Level Classification E-value
Superfamily BPTI-like 7.8e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.015
Further Details:      
 
Domain Number 5 Region: 123-173
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000132
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 37-88
Classification Level Classification E-value
Superfamily Elafin-like 0.000000144
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019008   Gene: ENSGGOG00000022330   Transcript: ENSGGOT00000028429
Sequence length 576
Comment pep:novel chromosome:gorGor3.1:5:33164349:33171435:-1 gene:ENSGGOG00000022330 transcript:ENSGGOT00000028429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAPRCRRFWSRWEQVAALLLLLLLLGVPPRSLALPPIRYSHAGICPNDMNPNLWVDAQS
TCRRECETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQG
SECDIWDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFT
WPNTSPPPPETTMHPTTASPETPELDMAAPALLNNPVHQSVTMGETVSFLCDVVGRPRPE
ITWEKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQLQDAGIYTCTARNAAGVLRADF
PLSVVRGHQAAATSESSPNGTAFPSAECLKPPDSEDCGEEQTRWHFDAQANNCLTFTFGH
CHRNLNHFETYEACMLACMSGPLAACSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCE
GNGNNFESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEADSGR
ALVTVDEVLKDEKMGLKFLGREPLEVTLLHVDWACPCPNVTVSEMPLIIMGEVDGGMAML
RPDSFVGASSARRVRKLREVMHKKTCDVLKEFLGLH
Download sequence
Identical sequences G3RT83
XP_004041424.1.27298 ENSGGOP00000019008 ENSGGOP00000019008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]