SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019184 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019184
Domain Number 1 Region: 43-198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-22
Family MAM domain 0.01
Further Details:      
 
Domain Number 2 Region: 238-339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000506
Family MAM domain 0.039
Further Details:      
 
Domain Number 3 Region: 6-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019184   Gene: ENSGGOG00000028327   Transcript: ENSGGOT00000026269
Sequence length 351
Comment pep:novel chromosome:gorGor3.1:10:19730654:19820935:1 gene:ENSGGOG00000028327 transcript:ENSGGOT00000026269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAQQGTESFQCDNGVSLPPDSICDFTDQCGDSSDERHCLNYERCDFEDGLCHMTQDQSLQ
PSWTKRNGMTGLSPPFYDHNGDVSAHFLSLVSRVDSISSSLRSRVFLPTNDQHDCQITFY
YFSCQVSGKLTVGLQTACGGPIQHLWQNTAAVPNQWERNVIKIQSSQRFQVVFEGQMAST
YEQDEVIAIDDISFSSGCLPANDGILLCQEALNAERELCHPDTDLCRFDATDEELRLCQA
CGFEFDMCEWTSEASAGQISWMHTKAREIPAFESTPQQDQGGDDEGYYVWVGAKHAFTLN
HLDSRAYLNSSVCHCGKSCHLQFYYAMESSVLRVRLYNNKVRRKLHLFQIH
Download sequence
Identical sequences ENSGGOP00000019184 ENSGGOP00000019184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]