SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021090 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000021090
Domain Number - Region: 502-582
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0419
Family PYP-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021090   Gene: ENSGGOG00000004435   Transcript: ENSGGOT00000031687
Sequence length 936
Comment pep:novel chromosome:gorGor3.1:16:17780730:18157676:-1 gene:ENSGGOG00000004435 transcript:ENSGGOT00000031687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPRGARGARSVSSLDSGAGERRGGAAVGGGEQPPPAPAPRRERRDLPAEPAAARGGGGGG
GGGGGGGRGPQARARGGGPGEPRGQQPASRGALPARALDPHPSLLITLETQDGYFSHRPK
EKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPELAKKPPSRQKELLKRKLEQQEKG
KGHTFPGKGPGEVLPPGDRAAANSSHGKDVSRPPHARKTGGSSPETKYDQPPKCDISGKE
AISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRFCPLEGKANKNVQWDEDSVEYMPA
NPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQVSRQYSNVRV
TPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYR
DMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFLLNRRFV
EYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKC
QYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEIIGQLDYYLYGNYPAG
TPGLRSYWENVYDEPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHP
ASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIASPPSDFGRLQFSEVG
TDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTVTVIWVDPINVIAATYDILIESTA
EFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNRQPIKPEEALKLHNGPL
RNAYMEQSFQSLNPVLSLPISPAQVEQARRNAASTGTGLEGWLDLLVGGMWTAMDICATG
PTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
Download sequence
Identical sequences ENSGGOP00000021090 ENSGGOP00000004352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]