SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023297 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023297
Domain Number 1 Region: 21-132
Classification Level Classification E-value
Superfamily Immunoglobulin 6.61e-19
Family V set domains (antibody variable domain-like) 0.00026
Further Details:      
 
Domain Number 2 Region: 137-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000961
Family C1 set domains (antibody constant domain-like) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023297   Gene: ENSGGOG00000023957   Transcript: ENSGGOT00000031569
Sequence length 305
Comment pep:novel chromosome:gorGor3.1:1:149321274:149322220:1 gene:ENSGGOG00000023957 transcript:ENSGGOT00000031569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPMLLLLSLLLGRSQALDGRFWLQVQESVMAQEGLCVSVMCSFSYPLELDESTSACGYWF
KEGTNTNMSALVATNSSKQVVQGRFQLIGDPHYQNCSLVIRDVQMEDTAVYFFRVKRGSF
VRYNFMNTFFLELTALTQKPDVYIPKALEHGKPVTVICVFNWAFEECPPPTFSWMGEAFS
FQGTGTTPSHFSVLNLTLRPQDHDTYHTCCIDFSRTGVSAWWTIQLFVAYTSSISYDNAP
TELASSRISSKKSGPMEAVVLVAIREGAVKILLLCICFTFLSVSFYRRKVMRAAVGVEAA
NTVTG
Download sequence
Identical sequences ENSGGOP00000023297 ENSGGOP00000023297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]