SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025807 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025807
Domain Number 1 Region: 20-119
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-48
Family V set domains (antibody variable domain-like) 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025807   Gene: ENSGGOG00000026832   Transcript: ENSGGOT00000026672
Sequence length 120
Comment pep:novel chromosome:gorGor3.1:15:1452967:1453416:-1 gene:ENSGGOG00000026832 transcript:ENSGGOT00000026672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWTWRILFLVAAATGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAP
GQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSEDTATYYCTRDTV
Download sequence
Identical sequences ENSGGOP00000025807 ENSGGOP00000025807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]