SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026035 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026035
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 2.98e-33
Family VPS28 N-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 103-178
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.57e-22
Family VPS28 C-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026035   Gene: ENSGGOG00000016214   Transcript: ENSGGOT00000031275
Sequence length 211
Comment pep:novel chromosome:gorGor3.1:8:144659569:144662260:-1 gene:ENSGGOG00000016214 transcript:ENSGGOT00000031275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAACSRLLVQYKAAFR
QVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDK
LRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWWVSLPARRSPAVPETLPAR
RSPAVPLRPSAPTCRVLHSQAADPERHVGVR
Download sequence
Identical sequences ENSGGOP00000026035 ENSGGOP00000015817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]