SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027604 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027604
Domain Number 1 Region: 25-113
Classification Level Classification E-value
Superfamily Immunoglobulin 3.91e-18
Family V set domains (antibody variable domain-like) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027604   Gene: ENSGGOG00000023106   Transcript: ENSGGOT00000032600
Sequence length 301
Comment pep:novel chromosome:gorGor3.1:5:141140164:141163626:-1 gene:ENSGGOG00000023106 transcript:ENSGGOT00000032600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSHLPFDCVSLCLNVFTVGSSEVEYRVEVGQNAYLPCFYTPAAPGNLVPVCWGKGVCPV
FECGNVVLRTDERDVNYRKSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMND
EKFNLKLVIKPAKVTPAPTLQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLA
NELRDSGLANELWDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLI
SLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSGQQPSQPFGCRFAI
P
Download sequence
Identical sequences ENSGGOP00000027604 ENSGGOP00000020592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]