SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028155 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028155
Domain Number 1 Region: 22-134
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-25
Family V set domains (antibody variable domain-like) 0.00011
Further Details:      
 
Domain Number 2 Region: 260-338
Classification Level Classification E-value
Superfamily Immunoglobulin 5.25e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 144-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000385
Family C2 set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028155   Gene: ENSGGOG00000028303   Transcript: ENSGGOT00000022964
Sequence length 383
Comment pep:novel chromosome:gorGor3.1:19:48993845:48997119:-1 gene:ENSGGOG00000028303 transcript:ENSGGOT00000022964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLLLLPLLSGGSPQEEPGYELQVQKSVTVQEGLCVLVSCSFSYPWRSWYSSPPLYVYW
FRDGGIPYYAEVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRV
ERGRDVKHSYQQNKLNLEVTALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGRPLTFSW
TGNALSPLDPETTRSSELTLTPRPEDHGTNLTCQVKRQGAQVTTERTVQLNVSYAPQNLA
ISIFFRNGTGTALRILSNGMSVPIQEGQSLFLACTVDSNPPASLSWFWEGKALNPSQTSM
SGTLELPNIGAREGGEFTCRVQHPLGSQHLSFILSVQRSSSSCICVTEKQQGSWPLVLTL
IRGALMGAGFLLTYGLTWIYYTR
Download sequence
Identical sequences ENSGGOP00000028155 ENSGGOP00000028155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]