SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028274 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028274
Domain Number 1 Region: 319-408
Classification Level Classification E-value
Superfamily Immunoglobulin 4.27e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 32-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000138
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 
Domain Number 3 Region: 132-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000352
Family I set domains 0.044
Further Details:      
 
Domain Number 4 Region: 220-311
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000116
Family V set domains (antibody variable domain-like) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028274   Gene: ENSGGOG00000012229   Transcript: ENSGGOT00000033413
Sequence length 535
Comment pep:novel chromosome:gorGor3.1:12:117832720:117873136:-1 gene:ENSGGOG00000012229 transcript:ENSGGOT00000033413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGSAPEPRVLVCLGALLAGWVAVGLEAVVIGEVHENVTLHCGNISGLRGQVTWYRNN
SEPVFLLSSNSSLRPAEPRFSLVDATSLHIESLSLGDEGNYTCQEILNVTQWFRVWLQVA
SGPYQIEVHIAATGTLPNGTLYAARGSQVDFSCNSSSRPPPMVEWWFQALNSSSESFGHN
LTVNFFSLLLISPNLQGNYTCLALNLLSKRHRKVTTELLVYYPPPSAPQCWAQMASGSFM
LQLTCRWDGGYPDPDFLWIEEPGGVILGKSKLGVEMLSESQLSDGKKFKCVTSHIVGPES
GASCMVQIRGPSLLSEPMKTCFIGGNVTLTCQVSGAYPPAKILWLRNLTQPEVVIQPSSR
HLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREVEIWLSVKEPLNIGGIVGTIVS
LLLLGLAIISGLLLYYSPVFCWKVGNTFRGQNMDDVMVLVDSEEEEEEEEDAAVEEQEGA
HEREELPKEIPKQDHIHRVTALVNGNIEQMGNGFQDLQDDSSEEQSDIVQEDRPV
Download sequence
Identical sequences ENSGGOP00000011935 ENSGGOP00000028274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]