SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028369 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028369
Domain Number 1 Region: 10-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.53e-43
Family G proteins 0.0000256
Further Details:      
 
Domain Number 2 Region: 189-227
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000497
Family SOCS box-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028369   Gene: ENSGGOG00000026664   Transcript: ENSGGOT00000030742
Sequence length 278
Comment pep:novel chromosome:gorGor3.1:X:100163789:100164817:1 gene:ENSGGOG00000026664 transcript:ENSGGOT00000030742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPGSPDQAYDFLLKFLLVGDSDVGKGEILESLQDGTAESPYSHLGGIDYKTTTILLDG
QRVKLKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIDEHAPGVP
KILVGNRLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRL
NWLGRPSKVLSLQDLCCRTIVSCIPVHLVDKLPLPIALRSHLKSFSMAKGLNARMMRGLS
YSLTTSSTHKRSSLCKVKIVCPPQSPPKNCTRNSCKIS
Download sequence
Identical sequences ENSGGOP00000028369 ENSGGOP00000028369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]